For the peptide YALGIIQAQPDKSESELVSQIIEELIKKEK, predict the electrospray ionization mass spectrum. Assume that the molecular weight of the uncharged peptide is 3400 Da.

a) The mass spectrum consists of a single peak at 3400 Da.
b) The mass spectrum shows multiple peaks corresponding to different charge states.
c) The mass spectrum is not predictable for the given peptide.
d) The mass spectrum is a continuous distribution.