07-01-2021
History

contestada

Describe the typical celebration that occurs on January 6

Respuesta :

07-01-2021

Answer:

The 3 kings something like that

Answer Link

fatcats234 fatcats234

07-01-2021

Answer: January 6 is Three Kings' Day

It celebrates the three wise men's visit to baby Jesus and also remembers his baptism

Explanation:

Answer Link

Otras preguntas

1) The skills and knowledge a person has acquired through experience and/or education. O Human Capital O Entrepreneurial talents O Physical Capital O Perfect co

The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the protein

In a softball game, a batter hits the ball at the velocity and angle shown below. What is the maximum range of the ball? Velocity = 32m/s 50° Range A. 95.1 m B.

plzz ans my previous questions

what is 1/4 as a percentage

What is one of the most threatened ecosystems in the United States ?

The medium sushee has 17 more ounces than the small slushee The large slushee has 6 times as many ounces than the small slushee The Slushee Company says there a

recent studies have shown that playing video games can actually have positive effects on a child's behavior's and development write some supporting details to s

What is the correct formula for copper(ii) oxide

What fraction is equal to 65%?