which type of iot application performs predictive analysis and initiates preemptive action using sensor data augmented with external data?

Question

08-11-2022
Computers and Technology

contestada

which type of iot application performs predictive analysis and initiates preemptive action using sensor data augmented with external data?

Respuesta :

Otras preguntas

The ancient Egyptian palette of marker (31st century nice) primary uses hierarchical scaling to convey its message of power and authority. True or false

Nine Weeks Test Select all the correct answers Which two characteristics of the city of Ur show that it has the unique features of a Mesopotamian civilization?

in 154 N38 what digit should be replaced to N to make the number divisible by 3,6 and 9?

TV−→− bisects ∠STU, m∠STV=(14x+8)∘, and m∠UTV=(x+2)∘. Find m∠STU

Why can't PCI alone denote the actual development of a country ? Give short reason.

Which of the following should college students do to keep track of their finances? A Pay for everything with a credit card. B. Use cash to pay for everything. C

What is a striation??

write a verbal sentence to represent 3n-35=79

WILL MARK BRAINLIEST Find the coordinates of the points of intersection of the graphs with coordinate axes: c y=− 1/4 x+2

The oligopeptide MNQSYGRLVSRAAIAATAMASLIKIFAWWY was cleaved by reaction with trypsin. Trypsin is a serine protease that hydrolyses peptide chains at the protein

BhawnaKumari BhawnaKumari · Answer 1 · 2022-11-15T08:03:15+01:00

"predict and adapt" is the type of IoT application that performs predictive analysis and initiates preemptive action using sensor data augmented with external data.

What is an IoT application? Why is it important?

A group of software and services known as an Internet of Things(IoT) application integrates data from numerous Internet of Things devices. In order to properly analyze this data and make decisions, it makes use of machine learning or artificial intelligence (AI) technology.

IoT has emerged as one of the most important technologies of the Seamless communication between people, processes, and things is now possible because to embedded devices that can connect commonplace items, such as kitchen appliances, cars, thermostats, and baby monitors, to the internet. Thanks to IoT, physical things can share and collect data without a lot of human intervention thanks to low-cost computing, the cloud, big data, analytics, and mobile technologies.

To learn more about IoT applications, use the given link
https://brainly.com/question/28942228
#SPJ4